PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.J460500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family M-type_MADS
Protein Properties Length: 354aa    MW: 39170.5 Da    PI: 12.4401
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.J460500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF86.51.5e-271058250
                       ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
             SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                       rien++nrqvtfskRrng+ KKA+ELSvLCd++va+++fs++g+l  +s
  Pavir.J460500.1.p 10 RIENTTNRQVTFSKRRNGLVKKAYELSVLCDIDVALLMFSPSGRLSHFS 58
                       8********************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.324161IPR002100Transcription factor, MADS-box
SMARTSM004325.5E-37160IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.14E-29278IPR002100Transcription factor, MADS-box
CDDcd002652.70E-37275No hitNo description
PRINTSPR004049.9E-25323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.1E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004049.9E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004049.9E-253859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MGRVKLPIRR IENTTNRQVT FSKRRNGLVK KAYELSVLCD IDVALLMFSP SGRLSHFSGR  60
SGVEDVILRY MNLPEHDRGG RSAVQNPEYL VSVLQRLKRE GRHGHAASQP RGTERESRGD  120
PAGNLFFAAA AAHLRGAPEV GDESPEAVRA RPCRVRIHER DRLLREELLA GRSHDPVRSG  180
SIWDGGDRWS ADAHGPSRGH GHVRRRRRAV GRRRRGVRRP WPPDVRRGRP VDVPQGPGRV  240
RRDLPGDQAA RRPVRRRRRR GSRRRGGGRS VAAGLHLHRA ALHALPPHAA LPGPGRRVPA  300
APGQQHGGGA GAGGNVGELL LRAQRRRRRW PTTAPWRPRT SPDLTSSPTV ITA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P7e-171101192Myocyte-specific enhancer factor 2B
1tqe_Q7e-171101192Myocyte-specific enhancer factor 2B
1tqe_R7e-171101192Myocyte-specific enhancer factor 2B
1tqe_S7e-171101192Myocyte-specific enhancer factor 2B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1205219RRRAVGRRRRGVRRP
2250257RRPVRRRR
3251259RPVRRRRRR
4254262RRRRRRGSR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLK3YIB68e-60K3YIB6_SETIT; Uncharacterized protein
STRINGSi013985m2e-59(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49533360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22130.12e-41AGAMOUS-like 104